PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000139.1.g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NF-YB
Protein Properties Length: 155aa    MW: 17599.6 Da    PI: 5.7432
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000139.1.g00012.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB156.44.9e-496100296
                           NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyv 80 
                                     +eqdr+lPianv+rimk+ lP++ak+sk+ak+ +qec++ef+sfvt+easdkc++e+rkt+ngdd++wa++ lGf++y+
  FANhyb_rscf00000139.1.g00012.1   6 EEQDRLLPIANVGRIMKQGLPQRAKVSKEAKQRMQECATEFLSFVTAEASDKCHKENRKTVNGDDICWAMSALGFDNYA 84 
                                     69***************************************************************************** PP

                           NF-YB  81 eplkvylkkyrelege 96 
                                     e+ + yl+kyre+e++
  FANhyb_rscf00000139.1.g00012.1  85 EATTRYLNKYREAERH 100
                                     *************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.5E-465107IPR009072Histone-fold
SuperFamilySSF471134.66E-368113IPR009072Histone-fold
PfamPF008082.1E-241175IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.0E-173957No hitNo description
PRINTSPR006151.0E-175876No hitNo description
PRINTSPR006151.0E-177795No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MVDHEEEQDR LLPIANVGRI MKQGLPQRAK VSKEAKQRMQ ECATEFLSFV TAEASDKCHK  60
ENRKTVNGDD ICWAMSALGF DNYAEATTRY LNKYREAERH RLAANQSNIN INTSSSSQFE  120
IREGDQLPIY LSGTQPPNLE FRILETGDNS FAKPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B8e-42796392Transcription factor HapC (Eurofung)
4g92_B8e-42796392Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004302413.11e-112PREDICTED: nuclear transcription factor Y subunit B-4
SwissprotO040271e-51NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLD7U9R62e-60D7U9R6_VITVI; Putative uncharacterized protein
STRINGVIT_14s0060g02660.t014e-60(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.15e-52nuclear factor Y, subunit B4